5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10Multimode Reader Comparison Chart. SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). The transparency of BNC‒Mannitol and BNC‒Minimal membranes were examined by light transmittance within the UV–visible range (200–700 nm) using a SpectraMax 384 spectrophotometer (Molecular Devices, Sunnyvale, CA, USA). Before you do a bottom read, or use high profile (6-well, 12-well, 24-well, or 48-well) plates, you must remove the plate adapter from the plate drawer. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. This user guide provides detailed instructions, troubleshooting tips and technical specifications for these instruments. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax M Series Multi-Mode Microplate Readers 3. Monochromator wavelength selection saves you the time and trouble of ever having to change out filters. 384 wells < 45 sec. Trilux 1450 Microbeta Liquid Scintillation and Luminescence Counter, Wallac (CAT#: STEM-SPO-0385-ZJF) Dynex MRX TC Revelation Microplate Reader, 100-240V, Dynex Technologies (CAT#: STEM-SPO-0076-YJL)The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. For high-range or. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. Glycan analysis with award-winning Fast Glycan technology. !Pathchecklm1000. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. 2. Model: SpectraMax PLUS 384. If no values are present, the water constant values are missing from the NVRAM. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 100 fmol 1536-well (8 µL) 0. 313 reference gain check fail. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. . Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. The value for 1000 should be higher than the value for 900. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. spr SpectraMax Plus 384. Temperature control and shaking come standard. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). Reliable performance with a proven track record. Assay setup for a 384-well low-volume plate. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. It measures the optical density (OD) of samples in both 96- and 384-well. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Tb donor/red acceptor. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. to View. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. . com Check our website for a current listing of worldwide distributors. The PathCheck sensor can extend the instrument linearity by a factor of three or more. When reading optical density at wavelengths below 340 nm, special UV-transparent, disposable or quartz microplates allowing transmission of the deep UV spectra must be used. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. 6-, 12-,. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. Read one sample or up to 384 in a single plate. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. 2. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. Spectramax i3 manual. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Temperature control. The top- and bottom-reading Gemini EM Microplate Reader with dual monochromators lets users determine the optimal excitation and emission settings for creative new fluorescence. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. to View Figures. Robust. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. PathCheck Sensor. Time Resolved Fluorescence. Detection of species collected on membrane plates is also possible. Community forums for Molecular Devices - SpectraMax 340PC384 Microplate Reader relating to Fatal Error 401 on LabWrench. 96- or 384-well microplate compatibility. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. Regularly used for NADPH ATPase assays, and BCA assays. 305 reference level saturation. Clearance . FilterMax F3 and F5 Multi-Mode; SpectraMax Paradigm® Multi-Mode. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. This kit is optimized for Molecular DevicesMolecular Devices Microplate Reader Spectramax 384 340PC. Digital controller and display. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The minimum order for this item is . SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. Molecular Devices also offers a mass spectrometry-based solution for food safety testingThe SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. Contact Us Phone: +1-800-635-5577 Web: Email: [email protected] are some cuvettes that have been tested in the M5 and Plus 384. High sample correlation coefficients (R 2) make it easy to. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. Handles plates with up to 384 wells. This user guide provides detailed instructions on how to set up, run, and analyze the validation tests, as well as how to troubleshoot common issues. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Wavelength Selection: Monochromator, tunable 1. When connecting for the first time to either the SpectraMax L reader or StakMax system. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. 100 fmol 1536-well (8 µL) 0. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Read one sample or up to 384 in a single plate eead using any standard cuvette, or 96-or 384-well microplate. 96 , 384 , and 1536 well microplates Note: Detection Cartridges and PC not included. It. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. 315 can't find zero order. GeneBLAzer® Compatible Microplate Reader Documentation. Products : SpectraMax 340PC 384 (Obsolete), SpectraMax Plus 384 reader. 0 fluorometer; BioMicroLab – XL20 tube sorter; Biobus; Thermo Scientific – NanoDrop 2000 Spectrophotometer; Thermofisher – Qubit FluorometerSpectraMax® L和SpectraMax® M5酶标仪均为CellTiter-Glo检测提供了优异的检测灵敏度。SpectraMax® L化学发光读板机带有自动增益功能,能同时进行模拟信号和光子计数,提供大于9个数量级的动态范围,对于高信号值样品无需稀释,同时对于低信号样品具有优越的灵敏度。After 3× washing, the plates were developed with ABTS substrate (Moss) and analyzed on a SpectraMax Plus 384 spectrophotometer (Molecular Devices) at optical density (OD) 405 nm. Each SpectraMax® 340 PC 384 Microplate Reader has an. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. 312 gain calibration failed. Applications. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. to 11. The SpectraMax® 340PC384 Reader from Molecular Devices provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro Data Acquisition and Analysis Software. where. Cell viability는 세포막 Integrity 또는. Manufacturer: Molecular Devices Model: SpectraMax Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. no. On the front panel of the instrument, press the load/eject button to move the microplate drawer outside of the instrument. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell-based assays. Technical specifications Detection limit for ATP Glow 0200-7012 (LUM) Optimized Guaranteed* 96-well (200 µL) 1. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. The dual monochromator optics allow the widest range of applications to be utilized for bioresearch and drug discovery applications, all without the need to change. Features. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M5e Microplate Reader transforms each well in a microplate to a fixed. Compact design. 384 wells: Abs 49 sec. Dimensions: 128mm (L) x 86mm (W) x. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. 96/384-FortheSpectraMax340PC384,presstoselecttoreada96-wellplateora384-wellplate. ester flash assays, in both 96- and 384-well plates. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software, spectramax i3 platform. 3) This warranty covers the SPECTRAmax PLUS 384384-well clear-bottom, scintillating microplate for cell-based radiometric proximity assays. The light should fall square on the slit. Total volume (except deep. VersaMaxreads96-wellplates. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). . Create custom fluorescence assays without having to purchase expensive filter sets. Page 12 Chapter 1 SpectraMax GEMINI EM Operator’s Manual. If desired, the samples can be transferred into cuvettes before reading. dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. Wavelength(s): 230 to 750 nm (depending on model) Features: Shaking, Temperature Control. 더 많은. reader in the visible range between 405–750 nm with NIST and NMI. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. . For more sample throughput, both readers can be easily integrated into full roboticMode 96-Well 384-Well 1536-Well Optimizedforspeed 20 seconds 33 seconds 68 seconds Optimizedforperformance 28 seconds 45 seconds 96 seconds Stop-and-go(off) 41 seconds 2 minutes <5 minutes. Statistics. Perform the following steps to install the drivers: Start > Control Panel > System. Computer and software not available. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. 303 unable to cal dark current. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. 5 cm x. Detection modalities are shown in Table 1-1. For the SpectraMax Plus 384 you can do fixed point cuvette reads. Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. Light Source: Xenon flash. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统, 包含8条样品检测光束和8条参比光束,给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Multimode Readers Comparison Chart. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. The SpectraMax® ABS Plus Microplate Reader can run . Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. Normally this fluorometric assay is performed in 96-well microplates. Chapter 1: General Information. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. , FI 45 sec. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Fluorescence filters included in 1nm range. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. It may be named "Pothos". Learn more about its features, specifications, and applications in this user. microplates or in a cuvette at a. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 9. used. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. SpectraMax M5. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). <p>384-well transparent tissue-culture treated (TC-treated) microplate for cell-based absorbance (colorimetric) assays. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Also see:. This white, polystyrene ProxiPlate™ has shallow wells allowing for lower volumes to be used in assays. Detection modalities are shown in Table 1-1. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time. Shaker Time: 0 to 999 seconds: Temperature Range. 1 Figure from 528 Publications Molecular Devices LLC. Expanding The Boundaries of Microplate Reader Functionality - The. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. For wavelengths in the UV range above 220 nm,. 012 fmol 0. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. This integrated system. Clearance . The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. High-precision 9 channel system; filter-less with up to 6 wavelengths. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. Model is Spectramax Plus 384. Set up SoftMax Pro Software to use PathCheck as detailed above. PathCheck sensor corrects optical pathlength & pipetting variation. Get the best deals for spectramax plus 384 at eBay. 304 signal level saturation. These upright laboratory refrigerators will fulfill all general-purpose applications, with adequate space for ventilation. com. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. formats from 6- to 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. Detection modalities are shown in Table 1-1. 304 signal level saturation. Customize data collection and analysis. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. 6 (H) x 22. The optical systems use two scanning monochromators soSpectramax Plus 384 Microplate Reader is available from The Lab World Group. There were 12 replicate wells per dilution in both 96-well and 384- well plates. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Wavelength optimization. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. Compare. 1. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Temperature range between 4°C above ambient to 45°C. Detection of species collected on membrane plates is also. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Note: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. The SpectraMax Paradigm Multi-Mode Detection. 0 OD for earlier models. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. 5 pM 2. Page 1The Molecular Devices SpectraMax M2 Microplate Reader is a multidetection microplate reader with dualmonochromators, dual-mode cuvette ports, and top-reading capability. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-Mode Molecular Devices SpectraMax Plus 384. ability to detect 16 ng/well of DNA and to quantitate 50 ng of . 0. Learn how SpectraMax Plus 384 Microplate Reader & SoftMax Pro Software used for Phenolic compounds measurement in red wines which efficiently collect and analyze the data for this assay. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. In case of a cuvette, the optical path is horizontal, hence. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. Labsystems Nepheloskan Ascent Microplate Reader. Includes: Computer Loaded with SoftMax Pro 5. Check: In the data table create two new columns and add the following formulas: !Pathchecklm900. . SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 2 5. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Next generation SpectraMax® absorbance microplate readers. Shaker time 0 to 999 seconds Temperature control Ambient. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. 190-1000 nm. The SpectraMax® Multi-Mode Microplate Reader provide great flexibility and include. Product Specs; Item SpectraMax Plus 384 Spectrophotometer; Company Molecular Devices LLC; This product is no longer available on Biocompare. Data can be analyzed and combined from different plates. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. The low profile increases robotic stack capacity and storage. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. Three low volume 24-well bottom slides. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. Also for: Spectramax plus. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3. SpectraMax® iD5 Multi-Mode Microplate Reader - Five-Mode Hybrid Microplate Reader with Automatic NFC Filter Identification and Western Blot Capability, Molecular Devices. Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. tools to expand the. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. The SpectraMax® ABS Plus Microplate Reader can run . With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The Molecular Devices SpectraMax 384 Plus is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. 030 fmol Fluorescence Polarization (FP). What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. Fixed a problem in SpectraMax Gemini setup when switching to luminescence where range checking errors were reported incorrectly. The excitation and the emission. It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. Reference diodes enable elimination of measurement noise due to slight fluctuations in. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 96-, 384-, and 1536-well plates (depending on. The adapter isThe SpectraMax Paradigm Multi Mode Detection Platform utilizes a patent pending design that allows for real time system configuration by the user in less than two minutes. 012 fmol 0. SpectraMax 190 reads 96-well plates. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. Essentially, all UV/VIS spectrophotometric assays that are read in a conventional spectrophotometer or micro plate reader can be read in the SpectraMax Plus: DNA/RNA/protein quantitation and purity. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. 996 (n = 3) ; for SpectraMax Plus 384 reader, r 2 = 0. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, FlexStation II (Obsolete), Gemini EM reader, FlexStation 3 reader. 190-1000 nm, tunable in 1 nm increments. Thermo LTQ Orbitrap Velos LC/MS System. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. The SpectraMax 340PC384 system has a monochromator instead of interference filters. TNF standard curve. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. In these readers, RLUs are proportional to counts/sec which doesn't change with. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. The SpectraMax. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Molecular Devices SpectraMax 340PC Microplate Spectrophotometer. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. Temperature control. ) 8. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. 7. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes. SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. SpectraMax190reads96-wellplates. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000 nm. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurement in the visible range. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. 190-1000 nm. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. Data of selected analytes in the graphs below illustrate sample correlations between 96-well and 384-well format of 16 human plasma samples. 0 nm increments. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. In luminescence mode, if you are specifying a wavelength for the read, you can select an emission bandwidth of either 15 nm or 25 nm. Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. Set up SoftMax Pro Software to use PathCheck as detailed above. Molecular Devices recommends that you use high-quality, doubleshielded cables to connect your SpectraMax. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. View the Molecular Devices website. Molecular Devices SpectraMax Plus 384. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Meso Scale Discovery 1250 Sector Imager 2400. The . Check the optical alignment, you will have to disassemble and remove optical cover. This revolution in modularity makes no compromise detection the norm.